Recombinant TNF beta,Mouse,AF

Key features and details:

• Expression System:scherichia coli
• Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:is-tag at the N-terminus
• Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

TNF-ÉÇ works as a potential mediator in the inflammatory and immune process. It a component of the TNF family of ligands, and signals through TNFR1 and TNFR2. TNF-ÉÇ is secreted by activated T and B lymphocytes, and has similar function to TNF-ϫ. In the same manner as TNF-ϫ, TNF-ÉÇ is involved in the regulation of various biological processes, including cell proliferation, differentiation, apoptosis, lipid metabolism, coagulation, and neurotransmission. TNF-ÉÇ is generally released as a soluble polypeptide. In addition, lymphotoxin-ÉÇ can anchor TNF-ÉÇ to the cell surface and form heterotrimers in an effective manner. TNF-ÉÇ is cytotoxic to a wide range of tumor cells.

Protein Accession:P09225.1

Gene ID:16992

Species:Mouse

Expression Sequence:

LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL with polyhistidine tag at the N-terminus.

Activity:

Measure by its ability to induce cytotoxicity in L929 cells in the presence of vactinomycin D. The ED50 for this effect is <30 ng/mL.

Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight:19.36 kDa

Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping:Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category:Cytokines

SDS-PAGE Image Name:mouse TNF beta

Datasheets and documents: