Recombinant TNF alpha,Swine,AF

Key features and details:

• Expression System:scherichia coli
• Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:is-tag at the C-terminus
• Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

TNF-ϫ is a kind of pleiotropic pro-inflammatory cytokine. It is secreted by various cells, such as adipocytes, activated monocytes, macrophages, B cells, T cells and fibroblasts. Proteolysis of the integral membrane precursor form of TNF-ϫ from cells soluble can release homotrimeric TNF-ϫ. TNF-ϫ can bind with some TNF-ϫ receptors induces apoptosis, besides, also trigger other responses depending on cell type, receptor expression, and signal transduction status. TNF-ϫ participate in the inflammatory response.

Protein Accession:P23563.1

Gene ID:397086

Species:Swine

Expression Sequence:

MLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to induce cytotoxicity in PK15 cells in the presence of the actinomycin D. The ED50 for this effect is <15 pg/mL.

Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight:18.1 kDa

Formulation:The protein was lyophilized from a solution containing 1X PBS, pH7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping:Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category:Cytokines

SDS-PAGE Image Name:swine TNF alpha

Datasheets and documents: