Recombinant TGF beta 2,Human,AF

Key features and details:

• Expression System:Escherichia coli
• Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:His-tag at the C-terminus
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

TGF-ض2 is a secreted protein known as a cytokine that performs many cellular functions and has a vital role during embryonic development. TGF-ض2 signaling begins with binding to a complex of the accessory receptor betaglycan and a type II ser/thr kinase receptor termed TGF-beta RII. This receptor then phosphorylates and activates another ser/thr kinase receptor, TGF-beta RI, or alternatively, ALK-1. The whole complex phosphorylates and activates Smad proteins that regulate transcription (3, 11, 12). Use of other signaling pathways that are Smad-independent allows for disparate actions observed in response to TGF-beta in different contexts.

Protein Accession: P61812.1

Gene ID: 7042

Species: Human

Expression Sequence:

MALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human TGF beta 2 is > 5 x 106 IU/mg.

Endotoxin level: <0.01 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 13.66 kDa

Formulation: The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. In some experiments, it recommends to add 10 mM HCl when reconstitute lyophilized protein.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human TGF beta 2

Datasheets and documents: