0 item(s)
View cart
You have no items in your shopping cart.
Key features and details:
- Expression System:Escherichia coli
- Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
- Fusion tag:His-tag at the C-terminus
- Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa
Product Description:
Protein Description:
Transforming growth factor alpha (TGF-ݴ) is a protein that in humans is encoded by the TGFA gene. TGF-alpha is a member of the EGF family of cytokines that are synthesized as transmembrane precursors and are characterized by the presence of one or several EGF structural units in their extracellular domain. Expression of TGF-alpha is widespread in tumors and transformed cells. TGF-alpha is also expressed in normal tissues during embryogenesis and in adult tissues, including pituitary, brain, keratinocytes, and macrophages.
Protein Accession: P01135.1
Gene ID: 7039
Species: Human
Expression Sequence:
MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA with polyhistidine tag at the C-terminus.
Activity:
Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human TGF alpha is > 5 x 106 IU/mg.
C3
Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.
Calculated Molecular Weight: 6.49 kDa
Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. In some experiments, it recommends to add 10 mM HCl when reconstitute lyophilized protein.
Shipping: Blue Ice
Stability and Storage:
Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.
Category: Cytokines
SDS-PAGE Image Name: human TGF alpha
Datasheets and documents:
When can I expect my order to ship?
Most orders are filled and shipped within 2-3 business days from the time they are received.
Our standard shipping usually take 2-5 days.
We also provide express shippping for time-sensitive deliveries.
Email contact@biofargo.com if you have any requirements.
