Recombinant LIF,Human,AF

Key features and details:

• Expression System:Escherichia coli
• Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:His-tag at the N-terminus
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

LIF, a pleiotrophic factor, is identified in multiple cell types, including T cells, myelomonocytic lineages, fibroblasts, liver, heart and melanoma. LIF is capable of promoting long-term maintenance of embryonic stem cells by inhibiting spontaneous differentiation. In addition, LIF also have abilities including stimulation of differentiation of cholinergic nerves, the stimulation of acute phase protein synthesis by hepatocytes, and suppression of adipogenesis by supressing the lipoprotein lipase in adipocytes.

Protein Accession: P15018.1

Gene ID: 3976

Species: Human

Expression Sequence:

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF with polyhistidine tag at the N-terminus.

Activity:

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <0.2 ng/mL.

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 20.52 kDa

Formulation: The protein was lyophilized from a solution containing 1XPBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human LIF

Datasheets and documents: