Recombinant IL-37,Human,AF

Key features and details:

• Expression System:Escherichia coli
• Purity/method:>95% as determined by SDS-PAGE. Ni-NTA chromatography.
• Fusion tag:His-tag at the C-terminus
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Decreasing synthesis of IL-37 in PBMCs will cause increasing production of pro-inflammatory cytokines such as IL-1 alpha, IL-1 beta, IL-6 and TNF- alpha. The IL-37 work as an innate inflammatory inhibitor is also proved by its high expression in synovial tissue from rheumatoid arthritis patients. Full length IL-37 locates mainly in the cytoplasm, and it can translocate to the nucleus after activation through cleavage by CASP1, then exerts its activity by directly interacting with SMAD3.

Protein Accession: Q9NZH6.1

Gene ID: 27178

Species: Human

Expression Sequence:

MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <0.9 ug/mL.

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 19.49 kDa

Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human IL-37

Datasheets and documents: