$64.29

FREE
SHIPPING

100% MONEY
BACK GUARANTEE

ONLINE
SUPPORT 24/7

Sku: CM032-5MP
Categories: Recombinant Protein

Key features and details:

  • Expression System:scherichia coli
  • Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
  • Fusion tag:is-tag at the C-terminus
  • Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Interleukin-36ϫ (IL-36 alpha ) binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. IL-36 eems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of proinflammatory cytokines such as TNF-alpha, IL-8 and IL-6. In cultured monocytes upregulates expression of IL-1A, IL-1B and IL-6. In myeloid dendritic cells involved in cell maturation by upregulating surface expression of CD83, CD86 and HLA-DR. In monocyte-derived dendritic cells facilitates dendritic cell maturation and drives T-cell proliferation. IL-36 may also play a role in proinflammatory effects in the lung.

Protein Accession:Q9JLA2.1

Gene ID:54448

Species:Mouse

Expression Sequence:

MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 alpha is > 1 x 105 IU/mg.

C3

Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight:18.82 kDa

Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping:Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category:Cytokines

SDS-PAGE Image Name:mouse IL-36 alpha

Datasheets and documents:

When can I expect my order to ship?

Most orders are filled and shipped within 2-3 business days from the time they are received.

Our standard shipping usually take 2-5 days.

We also provide express shippping for time-sensitive deliveries. 

Email contact@biofargo.com if you have any requirements.

 

Terms and Conditions