$64.29

FREE
SHIPPING

100% MONEY
BACK GUARANTEE

ONLINE
SUPPORT 24/7

Sku: CM020-5MP
Categories: Recombinant Protein

Key features and details:

  • Expression System:scherichia coli
  • Purity/method:95% as determined by SDS-PAGE. Ni-NTA chromatography.
  • Fusion tag:is-tag at the C-terminus
  • Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Interleukin-24 (IL-24) is a cytokine belonging to the IL-10 family of cytokines that signals through two heterodimeric receptors:IL-20R1/IL-20R2 and IL-22R1/IL-20R2. This interleukin is also known as melanoma differentiation-associated 7 (mda-7) due to its discovery as a tumour suppressing protein. IL-24 appears to control in cell survival and proliferation by inducing rapid activation of particular transcription factors called STAT1 and STAT3. This cytokine is predominantly released by activated monocytes, macrophages and T helper 2 (Th2) cells and acts on non-haematopoietic tissues such as skin, lung and reproductive tissues. IL-24 performs important roles in wound healing, arthritis, psoriasis and cancer. Several studies have shown that cell death occurs in cancer cells/cell lines following exposure to IL-24. The gene for IL-24 is located on chromosome 1 in humans.

Protein Accession:Q925S4.1

Gene ID:93672

Species:Mouse

Expression Sequence:

MQEFRFGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is <0.3 ng/mL.

C3

Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight:18.94 kDa

Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping:Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category:Cytokines

SDS-PAGE Image Name:mouse IL-24

Datasheets and documents:

When can I expect my order to ship?

Most orders are filled and shipped within 2-3 business days from the time they are received.

Our standard shipping usually take 2-5 days.

We also provide express shippping for time-sensitive deliveries. 

Email contact@biofargo.com if you have any requirements.

 

Terms and Conditions