You have no items in your shopping cart.

Key features and details:
- Expression System:Escherichia coli
- Purity/method:>95% as determined by SDS-PAGE. Ni-NTA chromatography.
- Fusion tag:His-tag at the C-terminus
- Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa
Product Description:
Protein Description:
Interleukin-24 (IL-24) is a cytokine belonging to the IL-10 family of cytokines that signals through two heterodimeric receptors: IL-20R1/IL-20R2 and IL-22R1/IL-20R2. This interleukin is also known as melanoma differentiation-associated 7 (mda-7) due to its discovery as a tumour suppressing protein. IL-24 appears to control in cell survival and proliferation by inducing rapid activation of particular transcription factors called STAT1 and STAT3. This cytokine is predominantly released by activated monocytes, macrophages and T helper 2 (Th2) cells and acts on non-haematopoietic tissues such as skin, lung and reproductive tissues. IL-24 performs important roles in wound healing, arthritis, psoriasis and cancer. Several studies have shown that cell death occurs in cancer cells/cell lines following exposure to IL-24. The gene for IL-24 is located on chromosome 1 in humans.
Protein Accession: Q13007.1
Gene ID: 11009
Species: Human
Expression Sequence:
MQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL with polyhistidine tag at the C-terminus.
Activity:
Measure by its ability to chemoattract BaF3 cells transfected with human IL-20R alpha and IL-20R beta. The ED50 for this effect is <100 pg/mL.
C3
Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.
Calculated Molecular Weight: 19.10 kDa
Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Shipping: Blue Ice
Stability and Storage:
Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.
Category: Cytokines
SDS-PAGE Image Name: human IL-24
Datasheets and documents:
When can I expect my order to ship?
Most orders are filled and shipped within 2-3 business days from the time they are received.
Our standard shipping usually take 2-5 days.
We also provide express shippping for time-sensitive deliveries.
Email contact@biofargo.com if you have any requirements.