Recombinant IL-22,Mouse,AF

Key features and details:

• Expression System:scherichia coli
• Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:is-tag at the C-terminus
• Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Interleukin-22 (IL-22) a member of a group of cytokines called the IL-10 family or IL-10 superfamily (including IL-19, IL-20, IL-24, and IL-26), a class of potent mediators of cellular inflammatory responses. It shares use of IL-10R2 in cell signaling with other members of this family, IL-10, IL-26, IL-28A/B and IL-29. IL-22 is produced by activated NK and T cells and initiates innate immune responses against bacterial pathogens especially in epithelial cells such as respiratory and gut epithelial cells. IL-22 along with IL-17 is rapidly produced by splenic LTi-like cells and also produced by Th17 cells and likely plays a role in the coordinated response of both adaptive innate immune systems, autoimmunity and tissue regeneration.

Protein Accession:Q9JJY9.1

Gene ID:50929

Species:Mouse

Expression Sequence:

MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to induce IL-10 secretion in COLO205 cells. The ED50 for this effect is <0.3 ng/mL.

Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight:17.58 kDa

Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping:Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category:Cytokines

SDS-PAGE Image Name:mouse IL-22

Datasheets and documents: