Recombinant IL-21,Human,AF

Key features and details:

• Expression System:Escherichia coli
• Purity/method:>95% as determined by SDS-PAGE. Ni-NTA chromatography.
• Fusion tag:His-tag at the C-terminus
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Interleukin-21 (IL21) belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Interleukin-21 is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. This cytokine induces cell division/proliferation in its target cells.

Protein Accession: Q9HBE4.3

Gene ID: 59067

Species: Human

Expression Sequence:

MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is <10 ng/mL.

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 16.2 kDa

Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human IL-21

Datasheets and documents: