Recombinant IGF-II,Mouse,AF

Key features and details:

• Expression System:scherichia coli
• Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:is-tag at the N-terminus
• Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Insulin-like growth factor 2 (IGF-2) is one of three protein hormones that share structural similarity to insulin. The major role of IGF-2 is as a growth promoting hormone during gestation. It is believed to be a major fetal growth factor in contrast to Insulin-like growth factor 1, which is a major growth factor in adults.

Protein Accession:P09535.1

Gene ID:16002

Species:Mouse

Expression Sequence:

AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE with polyhistidine tag at the N-terminus.

Activity:

Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is <6 ng/mL. The specific activity of recombinant mouse IGF-II is > 1.5 x 105 IU/mg.

Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight:8.20 kDa

Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping:Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category:Cytokines

SDS-PAGE Image Name:mouse IGF-II

Datasheets and documents: