$64.29

FREE
SHIPPING

100% MONEY
BACK GUARANTEE

ONLINE
SUPPORT 24/7

Sku: CM113-20HP
Categories: Recombinant Protein

Key features and details:

  • Expression System:Escherichia coli
  • Purity/method:>95% as determined by SDS-PAGE. Ni-NTA chromatography.
  • Fusion tag:His-tag at the C-terminus
  • Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure.

Protein Accession: P05019.1

Gene ID: 3479

Species: Human

Expression Sequence:

MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is 0.9-3.1 ng/mL. The specific activity of recombinant human IGF-I is approximately >1.2 x 103 IU/mg.

C3

Endotoxin level: <0.01 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 8.59 kDa

Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human IGF-I

Datasheets and documents:

When can I expect my order to ship?

Most orders are filled and shipped within 2-3 business days from the time they are received.

Our standard shipping usually take 2-5 days.

We also provide express shippping for time-sensitive deliveries. 

Email contact@biofargo.com if you have any requirements.

 

Terms and Conditions