Recombinant IFN gamma,Mouse,AF

Key features and details:

• Expression System:scherichia coli
• Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:is-tag at the C-terminus
• Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Interferon-ÎÛ is a effective multifunctional cytokine which is released mainly by activated NK cells and T cells. IFN-ÎÛ is primarily characterized based on its anti-viral activities, and then been proved to have several functions such as anti-proliferative, immune-regulatory, and pro-inflammatory activities. IFN-ÎÛ can upregulate expression of MHC class I and II antigen by antigen-presenting cells.

Protein Accession:P01580.1

Gene ID:15978

Species:Mouse

Expression Sequence:

MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to anti-viral assay in L-929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse IFN gamma is approximately >2x 106 IU/mg.

Endotoxin level:<0.01 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight:16.5 kDa

Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping:Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category:Cytokines

SDS-PAGE Image Name:mouse IFN gamma

Datasheets and documents: