Recombinant IFN beta 1a,Mouse,AF

Key features and details:

• Expression System:scherichia coli
• Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:is-tag at the C-terminus
• Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Interferon-beta is, a cytokine, released by fibroblasts and pathogen-exposed dendritic cells, macrophages, and endothelial cells. IFN beta 1a conducts through the heterodimeric IFN-alpha/beta Receptor. IFN-beta-deficient mice are easier to suffer from experimental autoimmune encephalomyelitis (EAE), a disease model of human multiple sclerosis (MS).In addition, IFN-beta has been proved to suppress the Th17 cell response in both MS and EAE and is usually used to treat MS disease.

Protein Accession:P01575.1

Gene ID:15977

Species:Mouse

Expression Sequence:

MINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN with polyhistidine tag at the C-terminus

Activity:

Measure by its ability to protect HeLa cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <5 pg/mL. The specific activity of recombinant mouse IFN beta 1a is > 1 x 109 IU/mg.

Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight:20.68 kDa

Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping:Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category:Cytokines

SDS-PAGE Image Name:mouse IFN beta 1a

Datasheets and documents: