Recombinant HMGB2,Human (mammalian cell expression),AF

Key features and details:

• Expression System:HEK293
• Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:His-SUMO tag at the N-terminus
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

HMGB2 is a member of the non-histone chromosomal high-mobility group protein family, which are chromatin-associated and wildly expressed in the nucleus of higher eukaryotic cells. HMGB2 can assist cooperative interactions between cis-acting proteins by promoting DNA flexibility through bending DNA to DNA circles. In addition, HMGB2 participates in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

Protein Accession: P26583.2

Gene ID: 3148

Species: Human

Expression Sequence:

MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE with polyhistidine-SUMO tag at the N-terminus

Activity:

N/A

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 35.57 kDa

Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human HMGB2

Datasheets and documents: