You have no items in your shopping cart.

Key features and details:
- Expression System:scherichia coli
- Purity/method:95% as determined by SDS-PAGE. Ni-NTA chromatography.
- Fusion tag:is-tag at the C-terminus
- Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa
Product Description:
Protein Description:
HMGB1 is present in the nuclei (chromatin associated) and cytoplasm of all cells and is a highly conserved protein in variety of species that. In the cytoplasm, HMGB1 is a regulator of autophagy, enhances cell survival, and limits apoptosis. It also can reduces protein aggregation caused by heat or chemical stress. HMGB1 is released to the extracellular milieu by inflammatory cells and by necrotic and apoptotic cells. Once released, it works as an inflammatory cytokine.HMGB1 is also secreted by macrophages and monocytes as a late response to LPS, TNF-ϫ, IL-1ÉÇ, or IFN-ÎÛ.
Protein Accession:P63158.2
Gene ID:15289
Species:Mouse
Expression Sequence:
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE with polyhistidine tag at the C-terminus
Activity:
Measure by its ability to induce TNF alpha in RAW264.7 cells. The ED50 for this effect is <15 ng/mL.
C3
Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.
Calculated Molecular Weight:25.56 kDa
Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Shipping:Blue Ice
Stability and Storage:
Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.
Category:Cytokines
SDS-PAGE Image Name:mouse HMGB1
Datasheets and documents:
When can I expect my order to ship?
Most orders are filled and shipped within 2-3 business days from the time they are received.
Our standard shipping usually take 2-5 days.
We also provide express shippping for time-sensitive deliveries.
Email contact@biofargo.com if you have any requirements.