Recombinant HMGB1 C23AC45AC106A,Human (mammalian cell expression),AF

Key features and details:

• Expression System:HEK293
• Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:His-SUMO tag at the N-terminus
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

HMGB1 is present in the nuclei (chromatin associated) and cytoplasm of all cells and is a highly conserved protein in variety of species that. In the cytoplasm, HMGB1 is a regulator of autophagy, enhances cell survival, and limits apoptosis. It also can reduces protein aggregation caused by heat or chemical stress. HMGB1 is released to the extracellular milieu by inflammatory cells and by necrotic and apoptotic cells. Once released, it works as an inflammatory cytokine.HMGB1 is also secreted by macrophages and monocytes as a late response to LPS, TNF-›¥, IL-1ض, or IFN-’�.

Protein Accession: P09429.3

Gene ID: 3146

Species: Human

Expression Sequence:

MGKGDPKKPRGKMSSYAFFVQTAREEHKKKHPDASVNFSEFSKKASERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFASEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE with polyhistidine-SUMO tag at the N-terminus

Activity:

Measure by its ability to induce TNF alpha in RAW264.7 cells. The ED50 for this effect is <10 ug/mL.

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 36.33 kDa

Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human HMGB1 C23AC45AC106A

Datasheets and documents: