Recombinant Galectin-9,Human,AF

Key features and details:

• Expression System:Escherichia coli
• Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:His-tag at the N-terminus
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Galectin-9 is belonging to the lectin family, that containing total 15 mammalian lectin members. Similar to other galectins, There is a carbohydrate recognition binding domain that enables Galectin-9 binding to ض-galactosides specifically. Most galectins are either bivalent or multivalent regarding their carbohydrate binding capacity, which enables the recognition of distinct signaling pathways. Galectin-9 may be retained intracellularly or transported to the cell surface where it can be cleaved to generate a soluble form. Galectin-9 functions in effector and regulatory phases of the immune response. During inflammation, the production of Galectin-9 in vivo generates a microenvironment that limits effector T cell responses. Galectin-9 can negatively regulate the Th1 immune response by engaging TIM-3 on T cells, which leads to induction of intracellular Ca2+ influx and activation of apoptosis pathways.

Protein Accession: O00182.2

Gene ID: 3965

Species: Human

Expression Sequence:

AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT with polyhistidine tag at the N-terminus.

Activity:

Measured by its ability of the immobilized protein to support the adhesion of Jurkat cells. The ED50 for this effect is <3 ug/mL.

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 36.7 kDa

Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human Galectin-9

Datasheets and documents: