You have no items in your shopping cart.
Key features and details:
- Expression System:Escherichia coli
- Purity/method:>95% as determined by SDS-PAGE. Ni-NTA chromatography.
- Fusion tag:His-tag at the N-terminus
- Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa
Product Description:
Protein Description:
Galectins are a class of proteins that bind specifically to ض-galactoside sugars. There have been 15 galectins discovered in mammals, encoded by the LGALS genes. Only galectin-1, -2, -3, -4, -7, -8, -9, -10 and -12 have been identified in humans. Galectin-13, also known as placental protein 13, is a placenta-specific galectin that induces the apoptosis of T lymphocytes, which may reduce the danger of maternal immune attacks on the fetal semiallograft during the long gestation of anthropoid primates.
Protein Accession: Q9UHV8.1
Gene ID: 29124
Species: Human
Expression Sequence:
SSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN with polyhistidine tag at the N-terminus.
Activity:
N/A
C3
Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.
Calculated Molecular Weight: 16.9 kDa
Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Shipping: Blue Ice
Stability and Storage:
Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.
Category: Cytokines
SDS-PAGE Image Name: human Galectin-13
Datasheets and documents:
When can I expect my order to ship?
Most orders are filled and shipped within 2-3 business days from the time they are received.
Our standard shipping usually take 2-5 days.
We also provide express shippping for time-sensitive deliveries.
Email contact@biofargo.com if you have any requirements.