You have no items in your shopping cart.
Key features and details:
- Expression System:Escherichia coli
- Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
- Fusion tag:His-tag at the N-terminus
- Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa
Product Description:
Protein Description:
G-CSF is a hematopoietic growth factor. It can activate the progress that committed progenitor cells develop to neutrophils and enhance the functional activities of the mature end-cell. It is secreted in response to specific stimulation by a variety of cells, including bone marrow stroma, macrophages, endothelial cells and fibroblasts. In clinical treatment, G-CSF is used to facilitate hematopoietic recovery after bone marrow transplantation.
Protein Accession: P09919.1
Gene ID: 1440
Species: Human
Expression Sequence:
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP with polyhistidine tag at the N-terminus.
Activity:
Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <50 pg/mL. The specific activity of recombinant human G-CSF is > 2 x 107 IU/mg.
C3
Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.
Calculated Molecular Weight: 19.48 kDa
Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Shipping: Blue Ice
Stability and Storage:
Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.
Category: Cytokines
SDS-PAGE Image Name: human G-CSF
Datasheets and documents:
When can I expect my order to ship?
Most orders are filled and shipped within 2-3 business days from the time they are received.
Our standard shipping usually take 2-5 days.
We also provide express shippping for time-sensitive deliveries.
Email contact@biofargo.com if you have any requirements.