You have no items in your shopping cart.
Key features and details:
- Expression System:Escherichia coli
- Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
- Fusion tag:His-tag at the C-terminus
- Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa
Product Description:
Protein Description:
FGF-20 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-20 signals through FGFR 2c and 3c, and is expressed during limb and brain development. Recombinant Human FGF-20 is a 23.2 kDa protein containing 209 amino acid residues.
Protein Accession: Q9NP95.1
Gene ID: 26281
Species: Human
Expression Sequence:
MPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT with polyhistidine tag at the C-terminus.
Activity:
Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 1.3-3.2 ng/mL. The specific activity of recombinant human FGF-20 is > 2 x 105 IU/mg.
C3
Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.
Calculated Molecular Weight: 24.24 kDa
Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Shipping: Blue Ice
Stability and Storage:
Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.
Category: Cytokines
SDS-PAGE Image Name: human FGF-20
Datasheets and documents:
When can I expect my order to ship?
Most orders are filled and shipped within 2-3 business days from the time they are received.
Our standard shipping usually take 2-5 days.
We also provide express shippping for time-sensitive deliveries.
Email contact@biofargo.com if you have any requirements.