Recombinant FGF-16,Human,AF

Key features and details:

• Expression System:Escherichia coli
• Purity/method:>95% as determined by SDS-PAGE. Ni-NTA chromatography.
• Fusion tag:His-tag at the C-terminus
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

FGF-16 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF16 expression is markedly increased in ovarian tumors, and FGF16 in conjunction with Wnt pathway contributes to the cancer phenotype of ovarian cells and suggests that modulation of its expression in ovarian cells might be a promising therapeutic strategy for the treatment of invasive ovarian cancers.

Protein Accession: O43320.1

Gene ID: 8823

Species: Human

Expression Sequence:

MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPV DPSKLPSMSR DLFHYR with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <31 ng/mL. The specific activity of recombinant human FGF-16 is > 3 x 104 IU/mg.

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 24.57 kDa

Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human FGF-16

Datasheets and documents: