You have no items in your shopping cart.

Key features and details:
- Expression System:Escherichia coli
- Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
- Fusion tag:His-tag at the C-terminus
- Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa
Product Description:
Protein Description:
FGF1, also known as an acidic fibroblast growth factor (aFGF), is a growth factor and signaling protein encoded by the FGF1 gene. FGF1 has used in studies on angiogenesis and mitogenesis of fibroblasts; tyrosine phosphorylation studies; neurite outgrowth studies in PC-12 cells, and receptor binding studies.
Protein Accession: P05230.1
Gene ID: 2246
Species: Human
Expression Sequence:
MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD with polyhistidine tag at the C-terminus.
Activity:
Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <0.3 ng/mL. The specific activity of recombinant human FGF-1 is > 1 x 106 IU/mg.
C3
Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.
Calculated Molecular Weight: 16.77 kDa
Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Shipping: Blue Ice
Stability and Storage:
Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.
Category: Cytokines
SDS-PAGE Image Name: human FGF-1
Datasheets and documents:
When can I expect my order to ship?
Most orders are filled and shipped within 2-3 business days from the time they are received.
Our standard shipping usually take 2-5 days.
We also provide express shippping for time-sensitive deliveries.
Email contact@biofargo.com if you have any requirements.