You have no items in your shopping cart.
Key features and details:
- Expression System:scherichia coli
- Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
- Fusion tag:is-tag at the N-terminus
- Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa
Product Description:
Protein Description:
CXCL9, also named Monokine, is a member of the CXC chemokine family and is induced by gamma interferon (MIG). Following induced by IFN-gamma, this chemokine can attract T-cells . CXCL9 has close relationship with two other CXC chemokines named CXCL10 and CXCL11, additionally they all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3. CXCL9 is also a cytokine that affects the growth, movement, or activation state of cells participating in immune and inflammatory response and work as a chemoattractant of activated T-cells.
Protein Accession:A0A4X1SX95
Gene ID:100135681
Species:Swine
Expression Sequence:
TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT with polyhistidine tag at the N-terminus.
Activity:
N/A
C3
Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.
Calculated Molecular Weight:12.88 kDa
Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Shipping:Blue Ice
Stability and Storage:
Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.
Category:Cytokines
SDS-PAGE Image Name:swine CXCL9
Datasheets and documents:
When can I expect my order to ship?
Most orders are filled and shipped within 2-3 business days from the time they are received.
Our standard shipping usually take 2-5 days.
We also provide express shippping for time-sensitive deliveries.
Email contact@biofargo.com if you have any requirements.