Recombinant CXCL9,Swine,AF

Key features and details:

• Expression System:scherichia coli
• Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:is-tag at the N-terminus
• Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

CXCL9, also named Monokine, is a member of the CXC chemokine family and is induced by gamma interferon (MIG). Following induced by IFN-gamma, this chemokine can attract T-cells . CXCL9 has close relationship with two other CXC chemokines named CXCL10 and CXCL11, additionally they all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3. CXCL9 is also a cytokine that affects the growth, movement, or activation state of cells participating in immune and inflammatory response and work as a chemoattractant of activated T-cells.

Protein Accession:A0A4X1SX95

Gene ID:100135681

Species:Swine

Expression Sequence:

TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT with polyhistidine tag at the N-terminus.

Activity:

N/A

Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight:12.88 kDa

Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping:Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category:Cytokines

SDS-PAGE Image Name:swine CXCL9

Datasheets and documents: