Recombinant CXCL5,Human,AF

Key features and details:

• Expression System:Escherichia coli
• Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:His-tag at the N-terminus
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

The protein encoded by this gene, Chemokine (C-X-C motif) ligand 5 (CXCL5), is a small cytokine belonging to the CXC chemokine family that is also known as epithelial-derived neutrophil-activating peptide 78 (ENA-78). This chemokine is produced concomitantly with interleukin-8 (IL8) in response to stimulation with either interleukin-1 (IL1) or tumor necrosis factor-alpha (TNFA). It is observed that, CXCL5 also expresses in eosinophils, and can interact with the type II interferon IFN- , thereby cause an inhibition. This chemokine stimulates the chemotaxis of neutrophils possesses angiogenic properties, and elicits these effects by interacting with the cell surface chemokine receptor CXCR2.

Protein Accession: P42830

Gene ID: 6374

Species: Human

Expression Sequence:

RELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN with polyhistidine tag at the N-terminus.

Activity:

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <10 ng/mL.

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 8.51 kDa

Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human CXCL5

Datasheets and documents: