Recombinant CXCL3,Mouse,AF

Key features and details:

• Expression System:scherichia coli
• Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:is-tag at the N-terminus
• Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

CXCL3 is an ELR CXC chemokine. Its structural and functional characteristics are similarto GRO1 (CXCL1), GRO2 (CXCL2), and interleukin-8 (CXCL8). CXC chemokines is critical in the phase I inflammation, in which the PMN cells are rapidly chemoattracted. In the next phase of inflammation, the CC chemokines (MCPs) attract different cell subpopulations such as T cells, monocytes, basophils, and eosinophils. MMP12, primarily released by macrophages, can modulate the activity of ELR-CXC chemokines and cleavage human CXCL1, CXCL2 and CXCL3 within the ELR sequence at Glu6-Leu7.

Protein Accession:AAI17017

Gene ID:330122

Species:Mouse

Expression Sequence:

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS with polyhistidine tag at the N-terminus.

Activity:

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <80 ng/mL.

Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight:8.72 kDa

Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping:Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category:Cytokines

SDS-PAGE Image Name:mouse CXCL3

Datasheets and documents: