You have no items in your shopping cart.

Key features and details:
- Expression System:scherichia coli
- Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
- Fusion tag:is-tag at the N-terminus
- Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa
Product Description:
Protein Description:
CXCL2 is an ELR CXC chemokine. The structural and functional characteritics of CSCL2 have relationship with with GRO1 (CXCL1), GRO3 (CXCL3), and interleukin-8 (CXCL8). It is produced by activated monocytes, neutrophils and macrophages. In addition, it also expresses at sites of inflammation. It has been detected that CXCL2 is highly expressed in serum of patients with the disease "esophageal squamous cell carcinoma" (ESCC) .
Protein Accession:P10889
Gene ID:20310
Species:Mouse
Expression Sequence:
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN with polyhistidine tag at the N-terminus.
Activity:
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <0.5 ng/mL.
C3
Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.
Calculated Molecular Weight:8.66 kDa
Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Shipping:Blue Ice
Stability and Storage:
Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.
Category:Cytokines
SDS-PAGE Image Name:mouse CXCL2
Datasheets and documents:
When can I expect my order to ship?
Most orders are filled and shipped within 2-3 business days from the time they are received.
Our standard shipping usually take 2-5 days.
We also provide express shippping for time-sensitive deliveries.
Email contact@biofargo.com if you have any requirements.