$64.29

FREE
SHIPPING

100% MONEY
BACK GUARANTEE

ONLINE
SUPPORT 24/7

Sku: CM009-5MP
Categories: Recombinant Protein

Key features and details:

  • Expression System:scherichia coli
  • Purity/method:95% as determined by SDS-PAGE. Ni-NTA chromatography.
  • Fusion tag:ag-free
  • Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

CXCL1/GROa act as a growth factor for melanoma cells. It is also a chemotaxin for neutrophils. Like other alpha chemokines, this protein is potent neutrophil attractant and activator and is also affect basophils. Clinical research show that CXCL1 protein may be a therapeutic target as well as a diagnostic marker in ovarian cancer.

Protein Accession:P12850.1

Gene ID:14825

Species:Mouse

Expression Sequence:

NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK.

Activity:

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <15 ng/mL.

C3

Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight:7.45 kDa

Formulation:The protein was lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping:Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category:Cytokines

SDS-PAGE Image Name:mouse CXCL1

Datasheets and documents:

When can I expect my order to ship?

Most orders are filled and shipped within 2-3 business days from the time they are received.

Our standard shipping usually take 2-5 days.

We also provide express shippping for time-sensitive deliveries. 

Email contact@biofargo.com if you have any requirements.

 

Terms and Conditions