Recombinant CXCL11,Swine,AF

Key features and details:

• Expression System:scherichia coli
• Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:is-tag at the N-terminus
• Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

CXCL11 has functional and structural relationship with CXCL9 and CXCL10. This CXC chemokine lacks a ELR (Glutamate-Leucine-Arginine) tripeptide motif.. Similar to CXCL9 and CXCL10, CXCL11 can specifically bind to the G protein-coupled receptor CXCR3 and involve in chemotaxis of immune cells and angiogenesis. Expression of both CXCR3 and CXCL11 by The Th1-associated cytokine IFNÎÛ can express both CXCR3 and CXCL11 and create an amplification loop of cell-mediated immune response between Th1 cells.

Protein Accession:B3GDY9

Gene ID:100169744

Species:Swine

Expression Sequence:

FPMFKAGRCLCIGPGVKAVKVADIEKVSIIHPSNNCDKTEVIVTLKAHKGRRCLNPKSKQANVIMKKVERMNFLRYQNV with polyhistidine tag at the N-terminus.

Activity:

N/A

Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight:9.72 kDa

Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping:Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category:Cytokines

SDS-PAGE Image Name:swine CXCL11

Datasheets and documents: