$64.29

FREE
SHIPPING

100% MONEY
BACK GUARANTEE

ONLINE
SUPPORT 24/7

Sku: CM166-5HP
Categories: Recombinant Protein

Key features and details:

  • Expression System:Escherichia coli
  • Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
  • Fusion tag:His-tag at the N-terminus
  • Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

CXCL11 has functional and structural relationship with CXCL9 and CXCL10. This CXC chemokine lacks a ELR (Glutamate-Leucine-Arginine) tripeptide motif.. Similar to CXCL9 and CXCL10, CXCL11 can specifically bind to the G protein-coupled receptor CXCR3 and involve in chemotaxis of immune cells and angiogenesis. Expression of both CXCR3 and CXCL11 by The Th1-associated cytokine IFN’� can express both CXCR3 and CXCL11 and create an amplification loop of cell-mediated immune response between Th1 cells.

Protein Accession: O14625

Gene ID: 6373

Species: Human

Expression Sequence:

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF with polyhistidine tag at the N-terminus.

Activity:

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <4 ng/mL.

C3

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 9.11 kDa

Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human CXCL11

Datasheets and documents:

When can I expect my order to ship?

Most orders are filled and shipped within 2-3 business days from the time they are received.

Our standard shipping usually take 2-5 days.

We also provide express shippping for time-sensitive deliveries. 

Email contact@biofargo.com if you have any requirements.

 

Terms and Conditions