You have no items in your shopping cart.
Key features and details:
- Expression System:scherichia coli
- Purity/method:98% as determined by SDS-PAGE. Ni-NTA chromatography
- Fusion tag:is-tag at the C-terminus
- Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa
Product Description:
Protein Description:
The ciliary neurotrophic factor is a protein that in humans is encoded by the CNTF gene. It is a hypothalamic neuropeptide that is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. CNTF has also been shown to be expressed by cells on the bone surface and to reduce the activity of bone-forming cells (osteoblasts).
Protein Accession:P51642.1
Gene ID:12803
Species:Mouse
Expression Sequence:
MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM with polyhistidine tag at the C-terminus.
Activity:
Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <10 ng/mL. The specific activity of recombinant mouse CNTF is > 1 x 105 IU/mg.
C3
Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.
Calculated Molecular Weight:23.40 kDa
Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Shipping:Blue Ice
Stability and Storage:
Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.
Category:Cytokines
SDS-PAGE Image Name:mouse CNTF
Datasheets and documents:
When can I expect my order to ship?
Most orders are filled and shipped within 2-3 business days from the time they are received.
Our standard shipping usually take 2-5 days.
We also provide express shippping for time-sensitive deliveries.
Email contact@biofargo.com if you have any requirements.