Recombinant CD30L,Human,AF

Key features and details:

• Expression System:Escherichia coli
• Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:His-tag at the C-terminus
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

CD30L is a member of the TNF superfamily, and is a type-II membrane-associated glycoprotein. It is primarily expressed on certain B cells, T cells, and monocytes. In lymphomas and various chronically inflamed tissues, CD30L can specifically bind to CD30 (receptor), which is expressed on activated, but not resting, B and T cells. CD30L can interact with CD30 to start a signaling cascade that can finally lead to the activation of NF-¿ÐB. CD30L/CD30 signaling applies pleiotropic effects on normal cells, for example: cell death, differentiation, and cell division. CD30L/CD30 signaling can also affect some kinds of diseases, like Hodgkin¨Ùs lymphoma, allergic inflammation, diabetes and mycobacterial infection.

Protein Accession: P32971

Gene ID: 944

Species: Human

Expression Sequence:

MQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <2 ng/mL.

Endotoxin level: <0.01 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 20.57 kDa

Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human CD30L

Datasheets and documents: