Recombinant CD27L,Human,AF

Key features and details:

• Expression System:Escherichia coli
• Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:His-tag at the N-terminus
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

CD27 Ligand, which belongs to the TNF superfamily, is a type II transmembrane protein. Like NK cells, CD27L is also located in activated T and B lymphocytes. Along with NK enhancement, CD27L and its receptor regulate the immune response by raising expansion and differentiation of T cell. CD27 signaling can act like a co-stimulatory effector to sustain survival of the CD8+ T cells, mainly by increasing expression of the IL-2 gene.

Protein Accession: P32970.2

Gene ID: 970

Species: Human

Expression Sequence:

QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP with polyhistidine tag at the N-terminus

Activity:

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <0.6 ng/mL.

Endotoxin level: <0.01 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 18.08 kDa

Formulation: The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human CD27L

Datasheets and documents: