Recombinant CCL4,Human,AF

Key features and details:

• Expression System:Escherichia coli
• Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:tag-free
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

CCL4 act as an important pro-inflammatory cytokine during acute and chronic inflammatory responses. CCL4 also play a role as an attractant NK cells, dendritic cells, monocytes, and lymphocytes to sites of injury and inflammation. As CCL4 conducts signaling through G-protein-coupled receptor CCR5, which is a major co-receptor for M-tropic HIV strains. Thus, binding of CCL4 to CCR5 inhibits HIV entry and reduces the cell surface expression of CCR5. CCL4 has been identified as one of the major anti-HIV factors produced by CD8+ T cells.

Protein Accession: P13236.1

Gene ID: 6351

Species: Human

Expression Sequence:

APMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN.

Activity:

Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <10 ng/mL.

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 7.75 kDa

Formulation: The protein was lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human CCL4

Datasheets and documents: