$64.29

FREE
SHIPPING

100% MONEY
BACK GUARANTEE

ONLINE
SUPPORT 24/7

Sku: CM069-5HP
Categories: Recombinant Protein

Key features and details:

  • Expression System:Escherichia coli
  • Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
  • Fusion tag:His-tag at the C-terminus
  • Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Bone morphogenetic protein 8A (BMP8A) is a polypeptide member of the TGFض superfamily of proteins. Like other BMPs, BMP8A is involved in the development of bone and cartilage. BMP8A may be involved in epithelial osteogenesis. It also plays a role in bone homeostasis. Human BMP 8a is synthesized as a large precursor protein that is cleaved at a dibasic cleavage site (RTPR) between aa residues 263 and 264 to release a 139 aa carboxy terminal domain.

Protein Accession: AAP74559

Gene ID: 353500

Species: Human

Expression Sequence:

MAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 10-19.4 ng/mL.

C3

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 16.61 kDa

Formulation: The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 MNaCl, pH 3.5.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human BMP-8a

Datasheets and documents:

When can I expect my order to ship?

Most orders are filled and shipped within 2-3 business days from the time they are received.

Our standard shipping usually take 2-5 days.

We also provide express shippping for time-sensitive deliveries. 

Email contact@biofargo.com if you have any requirements.

 

Terms and Conditions