$64.29

FREE
SHIPPING

100% MONEY
BACK GUARANTEE

ONLINE
SUPPORT 24/7

Sku: CM078-5HP
Categories: Recombinant Protein

Key features and details:

  • Expression System:Escherichia coli
  • Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
  • Fusion tag:His-tag at the C-terminus
  • Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Bone morphogenetic proteins (BMPs) are a group of growth factors also known as cytokines and as metabologens. Originally discovered by their ability to induce the formation of bone and cartilage, BMPs are now considered to constitute a group of pivotal morphogenetic signals, orchestrating tissue architecture throughout the body. The important function of BMP signals is emphasized by the multitude of roles for dysregulated BMP signaling in pathological processes. The cancerous disease often involves misregulation of the BMP signaling system. BMP-16 protein, like other bone morphogenetic proteins, plays an important role in the development of bone and cartilage.

Protein Accession: Q96S42

Gene ID: 4838

Species: Human

Expression Sequence:

MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <2.2 ng/mL.

C3

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 13.75 kDa

Formulation: The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 MNaCl, pH 3.5.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human BMP-16

Datasheets and documents:

When can I expect my order to ship?

Most orders are filled and shipped within 2-3 business days from the time they are received.

Our standard shipping usually take 2-5 days.

We also provide express shippping for time-sensitive deliveries. 

Email contact@biofargo.com if you have any requirements.

 

Terms and Conditions