Recombinant BMP-14,Human,AF

Key features and details:

• Expression System:Escherichia coli
• Purity/method:>98% as determined by SDS-PAGE. Ni-NTA chromatography
• Fusion tag:His-tag at the C-terminus
• Application: WB, ELISA, SDS-PAGE, Cell culture, Elisa

Product Description:

Protein Description:

Bone morphogenetic proteins (BMPs) are a group of growth factors also known as cytokines and as metabologens. BMP-14 is a principal inhibitor of cartilage development and is predominantly expressed in long bone during human embryonic development. Recombinant human BMP-14 is a 27 kDa homodimeric protein consisting of two 120 amino acid polypeptide chains.

Protein Accession: P43026

Gene ID: 8200

Species: Human

Expression Sequence:

MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR with polyhistidine tag at the C-terminus.

Activity:

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <14 ng/mL.

Endotoxin level: <0.1 EU per 1 ug of the protein by the LAL method.

Calculated Molecular Weight: 14.52 kDa

Formulation: The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 MNaCl, pH 3.5.

Reconstitution:

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Shipping: Blue Ice

Stability and Storage:

Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.

Category: Cytokines

SDS-PAGE Image Name: human BMP-14

Datasheets and documents: