You have no items in your shopping cart.
Key features and details:
- Expression System:scherichia coli
- Purity/method:95% as determined by SDS-PAGE. Ni-NTA chromatography.
- Fusion tag:is-tag at the C-terminus
- Application:WB, ELISA, SDS-PAGE, Cell culture, Elisa
Product Description:
Protein Description:
4-1BB Ligand Human Recombinant protein. 4-1BBL is a transmembrane cytokine that is part of the tumor necrosis factor (TNF) ligand family. Recombinant human 4-1BB ligand is intended for use in cell culture applications. 4-1BBL and its interaction with 4-1BB is involved in the antigen presenting process, proliferation of CD4 and CD8 positive T-cells, as well as cytokine secretion from T-cells.
Protein Accession:P41274
Gene ID:21950
Species:Mouse
Expression Sequence:
MRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE with polyhistidine tag at the C-terminus.
Activity:
Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is <0.05 ug/mL.
C3
Endotoxin level:<0.1 EU per 1 ug of the protein by the LAL method.
Calculated Molecular Weight:23.91 kDa
Formulation:The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Shipping:Blue Ice
Stability and Storage:
Lyophilized protein should be stored at -20 degrees Celsius for 1 year. Upon reconstitution, store at 2 degrees Celsius to 8 degrees Celsius for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20 degrees Celsius or -80 degrees Celsius for 3-6 months.
Category:Cytokines
SDS-PAGE Image Name:mouse 41BBL
Datasheets and documents:
When can I expect my order to ship?
Most orders are filled and shipped within 2-3 business days from the time they are received.
Our standard shipping usually take 2-5 days.
We also provide express shippping for time-sensitive deliveries.
Email contact@biofargo.com if you have any requirements.